Atlas Antibodies Anti-PSD3 Antibody
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA002455-100 | - | Atlas Antibodies HPA002455-100 Anti-PSD3 Antibody, pleckstrin and Sec7 domain containing 3 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | ||
HPA002455-25 | - | Atlas Antibodies HPA002455-25 Anti-PSD3 Antibody, pleckstrin and Sec7 domain containing 3 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-PSD3 Antibody
pleckstrin and Sec7 domain containing 3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PSD3
Alternative Gene Names
DKFZp761K1423, EFA6D, EFA6R, HCA67, KIAA0942
Target Protein
pleckstrin and Sec7 domain containing 3
Target Gene
PSD3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
FSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKDHRPETPSIKQ
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000013884 (92%)
Mouse ENSMUSG00000030465 (92%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|