CacheBy
Atlas Antibodies Anti-PSD3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSD3 Antibody

상품 한눈에 보기

Human PSD3 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 ICC 실험에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 확보. 40% glycerol buffer에 보존되어 안정적 사용 가능.

카탈로그번호
HPA002455-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002455-100 Anti-PSD3 Antibody, pleckstrin and Sec7 domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002455-25 Anti-PSD3 Antibody, pleckstrin and Sec7 domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSD3 Antibody

Anti-PSD3 Antibody

Target Protein: pleckstrin and Sec7 domain containing 3
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Also suitable for ICC applications.

Product Description

Polyclonal Antibody against Human PSD3.

Alternative Gene Names

DKFZp761K1423, EFA6D, EFA6R, HCA67, KIAA0942

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKDHRPETPSIKQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000013884 92%
Mouse ENSMUSG00000030465 92%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.