
Atlas Antibodies Anti-PSD3 Antibody
Human PSD3 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 ICC 실험에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 확보. 40% glycerol buffer에 보존되어 안정적 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-PSD3 Antibody
Anti-PSD3 Antibody
Target Protein: pleckstrin and Sec7 domain containing 3
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Also suitable for ICC applications.
Product Description
Polyclonal Antibody against Human PSD3.
Alternative Gene Names
DKFZp761K1423, EFA6D, EFA6R, HCA67, KIAA0942
Antigen Information
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKDHRPETPSIKQ
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000013884 | 92% |
| Mouse | ENSMUSG00000030465 | 92% |
Antibody Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



