CacheBy
Atlas Antibodies Anti-PSAT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSAT1 Antibody

상품 한눈에 보기

인간 PSAT1 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. 토끼에서 생산된 IgG 형식이며, 프레스티 항원으로 친화 정제되었습니다. 인간에 높은 반응성을 보이며, 40% 글리세롤 PBS 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA042924-100 Anti-PSAT1 Antibody, phosphoserine aminotransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042924-25 Anti-PSAT1 Antibody, phosphoserine aminotransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSAT1 Antibody

Anti-PSAT1 Antibody

Target Protein: phosphoserine aminotransferase 1
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PSAT1 (phosphoserine aminotransferase 1).


Alternative Gene Names

  • PSA

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (PrEST):
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

GAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAG

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000013971 97%
Mouse ENSMUSG00000024640 96%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Affinity purified using PrEST antigen as ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.