Atlas Antibodies Anti-PRX Antibody

상품 한눈에 보기

인체 PRX 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC를 통한 단백질 발현 Orthogonal 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human 종에 반응하며 PRX 유전자 연구에 활용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001868-100 Anti-PRX Antibody, periaxin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001868-25 Anti-PRX Antibody, periaxin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: periaxin
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human PRX

항목	내용
Target Protein	periaxin
Target Gene	PRX
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000053198 (73%), Rat ENSRNOG00000018369 (68%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPSVELDL

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.