CacheBy
Atlas Antibodies Anti-PSAP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSAP Antibody

상품 한눈에 보기

인간 PSAP 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 Rabbit IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. RNA-seq 데이터 기반 Orthogonal 검증을 통해 높은 특이성과 신뢰성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA004426-100 Anti-PSAP Antibody, prosaposin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004426-25 Anti-PSAP Antibody, prosaposin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSAP Antibody

Anti-PSAP Antibody

Target Protein: prosaposin
Supplier: Atlas Antibodies

  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Orthogonal Validation: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC: Immunocytochemistry application.

Product Description

Polyclonal Antibody against Human PSAP

Alternative Gene Names

GLBA, SAP1

Open Datasheet

Specifications

항목 내용
Target Protein prosaposin
Target Gene PSAP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000000571 (56%), Mouse ENSMUSG00000004207 (51%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

TNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEE

Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.