
Atlas Antibodies Anti-PRR11 Antibody
상품 한눈에 보기
Human PRR11 단백질을 인식하는 고품질 폴리클로날 항체로, WB 및 IHC에 적합합니다. Rabbit 호스트에서 제조되었으며, PrEST 항원으로 친화 정제되었습니다. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현을 교차 검증했습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRR11 Antibody
Target Protein: Proline Rich 11 (PRR11)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against human PRR11.
Alternative Gene Names
- FLJ11029
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
LAPVLLRKPSLAKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVTLKPNSKVLSTR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000020493 | 76% |
| Rat | ENSRNOG00000006198 | 74% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PRR14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPSAP2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.