Atlas Antibodies Anti-PRR11 Antibody

상품 한눈에 보기

Human PRR11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합. Orthogonal validation으로 단백질 발현 검증. PrEST 항원으로 친화정제되었으며, 40% glycerol/PBS 완충액에 보존됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023923-100 Anti-PRR11 Antibody, proline rich 11 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023923-25 Anti-PRR11 Antibody, proline rich 11 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: proline rich 11 (PRR11)
Type: Polyclonal Antibody against Human PRR11

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal antibody recognizing human PRR11, validated for use in multiple applications.

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
LAPVLLRKPSLAKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVTLKPNSKVLSTR

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000020493	76%
Rat	ENSRNOG00000006198	74%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)