
Atlas Antibodies Anti-PRPH Antibody
상품 한눈에 보기
Human PRPH 단백질(peripherin)을 인식하는 Rabbit Polyclonal 항체. IHC 검증 완료 및 독립 항체 비교를 통한 단백질 발현 검증. Affinity purification으로 높은 특이성과 재현성 확보. Human에 반응하며 Mouse, Rat에서도 높은 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRPH Antibody
Target Protein: peripherin
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PRPH
Alternative Gene Names
NEF4, PRPH1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | peripherin |
| Target Gene | PRPH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQEL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000023484 (92%), Rat ENSRNOG00000052880 (92%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PRR12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPSAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPH2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPS1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.