CacheBy
Atlas Antibodies Anti-PRPH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRPH Antibody

상품 한눈에 보기

Human PRPH 단백질(peripherin)을 인식하는 Rabbit Polyclonal 항체. IHC 검증 완료 및 독립 항체 비교를 통한 단백질 발현 검증. Affinity purification으로 높은 특이성과 재현성 확보. Human에 반응하며 Mouse, Rat에서도 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039277-100 Anti-PRPH Antibody, peripherin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039277-25 Anti-PRPH Antibody, peripherin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRPH Antibody

Anti-PRPH Antibody

Target Protein: peripherin
Supplier: Atlas Antibodies


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human PRPH


Alternative Gene Names

NEF4, PRPH1

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein peripherin
Target Gene PRPH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQEL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000023484 (92%), Rat ENSRNOG00000052880 (92%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.