CacheBy
Atlas Antibodies Anti-PRPS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRPS1 Antibody

상품 한눈에 보기

Human PRPS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PRPS1 관련 연구에 활용 가능하며, 친화 정제되어 높은 특이성과 재현성을 제공합니다. 글리세롤 기반 완충액에 보존되어 안정적입니다.

카탈로그번호
HPA043760-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043760-100 Anti-PRPS1 Antibody, phosphoribosyl pyrophosphate synthetase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043760-25 Anti-PRPS1 Antibody, phosphoribosyl pyrophosphate synthetase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRPS1 Antibody

Anti-PRPS1 Antibody

Target Protein: phosphoribosyl pyrophosphate synthetase 1 (PRPS1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PRPS1.


Alternative Gene Names

CMTX5, DFN2, DFNX1

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
  • Antigen Sequence:
    LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Antigen Sequence Identity
Rat ENSRNOG00000028627 39%
Mouse ENSMUSG00000002100 36%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.