CacheBy
Atlas Antibodies Anti-PRPH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRPH Antibody

상품 한눈에 보기

Human PRPH(peripherin)을 인식하는 rabbit polyclonal antibody로, IHC 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장. 인간, 생쥐, 랫트 간 높은 서열 유사성(92%) 확인.

카탈로그번호
HPA063887-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063887-100 Anti-PRPH Antibody, peripherin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063887-25 Anti-PRPH Antibody, peripherin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRPH Antibody

Anti-PRPH Antibody (Atlas Antibodies)

Target Information

  • Protein: Peripherin
  • Gene: PRPH
  • Alternative Gene Names: NEF4, PRPH1

Product Description

Polyclonal antibody against human PRPH (peripherin).
Validated for use in immunohistochemistry (IHC) through comparison of independent antibodies recognizing different epitopes.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    FSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQEL

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000023484 92%
Rat ENSRNOG00000052880 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes Gently mix before use. Determine optimal concentrations and conditions experimentally.

Material Safety Data Sheet

Additional Resources

Open Datasheet (PDF)

제품 이미지

Enhanced Validation
IHC Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.