
Atlas Antibodies Anti-PRPH Antibody
상품 한눈에 보기
Human PRPH(peripherin)을 인식하는 rabbit polyclonal antibody로, IHC 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장. 인간, 생쥐, 랫트 간 높은 서열 유사성(92%) 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRPH Antibody (Atlas Antibodies)
Target Information
- Protein: Peripherin
- Gene: PRPH
- Alternative Gene Names: NEF4, PRPH1
Product Description
Polyclonal antibody against human PRPH (peripherin).
Validated for use in immunohistochemistry (IHC) through comparison of independent antibodies recognizing different epitopes.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
FSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQEL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000023484 | 92% |
| Rat | ENSRNOG00000052880 | 92% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage Notes | Gently mix before use. Determine optimal concentrations and conditions experimentally. |
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PRPS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPSAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPF6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPF4B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.