
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PRPH Antibody
상품 한눈에 보기
Human PRPH(peripherin)을 인식하는 rabbit polyclonal antibody로, IHC 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장. 인간, 생쥐, 랫트 간 높은 서열 유사성(92%) 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA063887-100 Anti-PRPH Antibody, peripherin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063887-25 Anti-PRPH Antibody, peripherin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PRPH Antibody
Anti-PRPH Antibody (Atlas Antibodies)
Target Information
- Protein: Peripherin
- Gene: PRPH
- Alternative Gene Names: NEF4, PRPH1
Product Description
Polyclonal antibody against human PRPH (peripherin).
Validated for use in immunohistochemistry (IHC) through comparison of independent antibodies recognizing different epitopes.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
FSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQEL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000023484 | 92% |
| Rat | ENSRNOG00000052880 | 92% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage Notes | Gently mix before use. Determine optimal concentrations and conditions experimentally. |
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



