CacheBy
Atlas Antibodies Anti-PRPF4B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRPF4B Antibody

상품 한눈에 보기

Human PRPF4B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 프리-mRNA processing factor 4B를 표적으로 하며, 높은 종간 보존성을 보입니다. PrEST 항원을 이용해 친화 정제되었습니다.

카탈로그번호
HPA020638-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020638-100 Anti-PRPF4B Antibody, pre-mRNA processing factor 4B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020638-25 Anti-PRPF4B Antibody, pre-mRNA processing factor 4B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRPF4B Antibody

Anti-PRPF4B Antibody

Target: pre-mRNA processing factor 4B


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PRPF4B.


Alternative Gene Names

KIAA0536, PR4H, Prp4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein pre-mRNA processing factor 4B
Target Gene PRPF4B
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence LEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMF

Species Reactivity

반응성 유사도
Human Verified -
Mouse Predicted 97%
Rat Predicted 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.