
Atlas Antibodies Anti-PRPF4 Antibody
상품 한눈에 보기
Human PRPF4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 독립 항체 검증을 통해 신뢰성 높은 결과를 제공합니다. PRPF4의 발현 및 기능 연구용으로 권장됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRPF4 Antibody
pre-mRNA processing factor 4
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human PRPF4.
Alternative Gene Names
HPRP4, HPRP4P, PRP4, Prp4p, SNRNP60
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | pre-mRNA processing factor 4 |
| Target Gene | PRPF4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDS |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | Verified |
| Rat | Verified |
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000014777 (97%)
- Mouse ENSMUSG00000066148 (97%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PRPF4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPF40A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPF4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPF40A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRPF39 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.