AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PRPF4 Antibody
상품 한눈에 보기
Human PRPF4 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며 독립 항체 비교를 통한 검증 완료. Rabbit 호스트 기반, IgG 아이소타입, Affinity purification 방식으로 높은 특이성과 재현성 제공.
- 카탈로그번호
- HPA022248-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA022248-100 Anti-PRPF4 Antibody, pre-mRNA processing factor 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022248-25 Anti-PRPF4 Antibody, pre-mRNA processing factor 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PRPF4 Antibody
Anti-PRPF4 Antibody
Target Information
- Target Protein: pre-mRNA processing factor 4
- Target Gene: PRPF4
- Alternative Gene Names: HPRP4, HPRP4P, PRP4, Prp4p, SNRNP60
Product Description
Polyclonal antibody against human PRPF4. Validated for protein expression through independent antibody comparison in IHC and WB.
Recommended Applications
- IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Independent validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- ICC: Suitable for immunocytochemistry applications.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDS
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000014777 | 97% |
| Mouse | ENSMUSG00000066148 | 97% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.