
Atlas Antibodies Anti-PPP2R3A Antibody
상품 한눈에 보기
Human PPP2R3A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. siRNA knockdown으로 유전학적 검증 완료. 높은 종 간 반응성(인간, 마우스, 랫트). PrEST 항원을 이용한 친화 정제 제품.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP2R3A Antibody
Target: protein phosphatase 2, regulatory subunit B'', alpha
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Genetic validation in WB by siRNA knockdown
Product Description
Polyclonal antibody against human PPP2R3A.
Alternative Gene Names
PPP2R3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 2, regulatory subunit B'', alpha |
| Target Gene | PPP2R3A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000022999 (85%)
- Mouse ENSMUSG00000043154 (85%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPP2R3C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R3B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R2D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP2R3A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.