CacheBy
Atlas Antibodies Anti-PPP2R3A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP2R3A Antibody

상품 한눈에 보기

Human PPP2R3A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. siRNA knockdown으로 유전학적 검증 완료. 높은 종 간 반응성(인간, 마우스, 랫트). PrEST 항원을 이용한 친화 정제 제품.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035829-100 Anti-PPP2R3A Antibody, protein phosphatase 2, regulatory subunit B``, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035829-25 Anti-PPP2R3A Antibody, protein phosphatase 2, regulatory subunit B``, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP2R3A Antibody

Anti-PPP2R3A Antibody

Target: protein phosphatase 2, regulatory subunit B'', alpha
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
    Genetic validation in WB by siRNA knockdown

Product Description

Polyclonal antibody against human PPP2R3A.

Alternative Gene Names

PPP2R3

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein protein phosphatase 2, regulatory subunit B'', alpha
Target Gene PPP2R3A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000022999 (85%)
  • Mouse ENSMUSG00000043154 (85%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.