
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP2R3A Antibody
상품 한눈에 보기
Human PPP2R3A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. siRNA knockdown으로 유전학적 검증 완료. 높은 종 간 반응성(인간, 마우스, 랫트). PrEST 항원을 이용한 친화 정제 제품.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA035829-100 Anti-PPP2R3A Antibody, protein phosphatase 2, regulatory subunit B``, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035829-25 Anti-PPP2R3A Antibody, protein phosphatase 2, regulatory subunit B``, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP2R3A Antibody
Anti-PPP2R3A Antibody
Target: protein phosphatase 2, regulatory subunit B'', alpha
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Genetic validation in WB by siRNA knockdown
Product Description
Polyclonal antibody against human PPP2R3A.
Alternative Gene Names
PPP2R3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 2, regulatory subunit B'', alpha |
| Target Gene | PPP2R3A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000022999 (85%)
- Mouse ENSMUSG00000043154 (85%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



