CacheBy
Atlas Antibodies Anti-PPP2R2D Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP2R2D Antibody

상품 한눈에 보기

Human PPP2R2D 단백질을 인식하는 Rabbit Polyclonal 항체로, 단백질 인산화효소 2의 조절 서브유닛 B, delta를 타깃으로 함. IHC 등 다양한 응용에 적합하며, 높은 종 간 보존성과 특이성을 제공. Affinity purification 방식으로 제조됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA042770-100 Anti-PPP2R2D Antibody, protein phosphatase 2, regulatory subunit B, delta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042770-25 Anti-PPP2R2D Antibody, protein phosphatase 2, regulatory subunit B, delta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP2R2D Antibody

Anti-PPP2R2D Antibody

Target: protein phosphatase 2, regulatory subunit B, delta
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human PPP2R2D.


Alternative Gene Names

  • MDS026

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein protein phosphatase 2, regulatory subunit B, delta
Target Gene PPP2R2D
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM
Verified Species Reactivity Human
Ortholog Identity Rat ENSRNOG00000016940 (100%), Mouse ENSMUSG00000041769 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.