
Atlas Antibodies Anti-PPP1R14A Antibody
상품 한눈에 보기
Human PPP1R14A 단백질에 특이적인 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합. RNA-seq 데이터 기반의 직교 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human, Rat, Mouse에 반응.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP1R14A Antibody
Target: protein phosphatase 1, regulatory (inhibitor) subunit 14A
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal antibody against Human PPP1R14A.
Alternative Gene Names
- CPI-17
- PPP1INL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 1, regulatory (inhibitor) subunit 14A |
| Target Gene | PPP1R14A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000020676 | 92% |
| Mouse | ENSMUSG00000037166 | 89% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPP1R12C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R14A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R14A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R13L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R12B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.