CacheBy
Atlas Antibodies Anti-PPP1R14A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP1R14A Antibody

상품 한눈에 보기

Human PPP1R14A 단백질에 특이적인 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합. RNA-seq 데이터 기반의 직교 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human, Rat, Mouse에 반응.

카탈로그번호
HPA042097-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042097-100 Anti-PPP1R14A Antibody, protein phosphatase 1, regulatory (inhibitor) subunit 14A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042097-25 Anti-PPP1R14A Antibody, protein phosphatase 1, regulatory (inhibitor) subunit 14A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP1R14A Antibody

Anti-PPP1R14A Antibody

Target: protein phosphatase 1, regulatory (inhibitor) subunit 14A
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human PPP1R14A.


Alternative Gene Names

  • CPI-17
  • PPP1INL

Target Information

항목 내용
Target Protein protein phosphatase 1, regulatory (inhibitor) subunit 14A
Target Gene PPP1R14A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000020676 92%
Mouse ENSMUSG00000037166 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.