Atlas Antibodies Anti-PPP1R12C Antibody

상품 한눈에 보기

인간 PPP1R12C 단백질을 인식하는 고품질 폴리클로날 항체입니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원 기반 친화 정제 방식 사용. IHC 등 다양한 응용 가능하며, 인간, Rat, Mouse에서 높은 반응성 확인. 보존용으로 40% 글리세롤 및 PBS(pH 7.2) 버퍼 포함.

카탈로그번호: HPA043532-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043532-100 Anti-PPP1R12C Antibody, protein phosphatase 1, regulatory subunit 12C 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043532-25 Anti-PPP1R12C Antibody, protein phosphatase 1, regulatory subunit 12C 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PPP1R12C Antibody

Anti-PPP1R12C Antibody

Target: protein phosphatase 1, regulatory subunit 12C
Supplier: Atlas Antibodies

Recommended Applications

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human PPP1R12C

Alternative Gene Names

DKFZP434D0412, LENG3, MBS85, p84, p85

Open Datasheet

Target Information

Target Protein: protein phosphatase 1, regulatory subunit 12C
Target Gene: PPP1R12C

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000053828 (99%)
Mouse ENSMUSG00000019254 (99%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand