원본
Thermo Fisher Scientific NME1 Polyclonal Antibody
상품 한눈에 보기
Human, Mouse, Rat 반응성을 가진 Rabbit Polyclonal NME1 항체. Western blot, IHC, ICC, Flow cytometry 등 다양한 응용에 적합. 항원 친화 크로마토그래피로 정제된 고순도 제품. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 05:30
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579743 NME1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific NME1 Polyclonal Antibody
Applications 및 Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26–58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746858 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
NME1은 전이성이 높은 세포에서 mRNA 전사 수준이 감소된 것으로 확인된 단백질입니다. Nucleoside diphosphate kinase (NDK)는 A(NME1)와 B(NME2) 아이소폼이 결합된 헥사머 형태로 존재합니다. 이 유전자 변이는 공격적인 신경모세포종에서 발견되며, 두 가지 전사 변형체가 보고되었습니다. 또한 NME1과 인접한 NME2 유전자의 공동 전사로 인해 두 단백질 서열을 모두 포함하는 융합 단백질(NME1-NME2)이 생성됩니다.
주의사항
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific NME1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific NMI Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific NME2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific NLRP4G Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.