Thermo Fisher Scientific NME1 Polyclonal Antibody
Human, Mouse, Rat 반응성을 가진 Rabbit Polyclonal NME1 항체. Western blot, IHC, ICC, Flow cytometry 등 다양한 응용에 적합. 항원 친화 크로마토그래피로 정제된 고순도 제품. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications 및 Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26–58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746858 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
NME1은 전이성이 높은 세포에서 mRNA 전사 수준이 감소된 것으로 확인된 단백질입니다. Nucleoside diphosphate kinase (NDK)는 A(NME1)와 B(NME2) 아이소폼이 결합된 헥사머 형태로 존재합니다. 이 유전자 변이는 공격적인 신경모세포종에서 발견되며, 두 가지 전사 변형체가 보고되었습니다. 또한 NME1과 인접한 NME2 유전자의 공동 전사로 인해 두 단백질 서열을 모두 포함하는 융합 단백질(NME1-NME2)이 생성됩니다.
주의사항
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific NME1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NMI Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NME1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NME2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NLRP4G Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|