
Atlas Antibodies Anti-CKAP4 Antibody
상품 한눈에 보기
인간 CKAP4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. Orthogonal 및 Independent validation 수행. CLIMP-63 등 대체 유전자명 포함. 고순도 Affinity 정제 및 인체 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CKAP4 Antibody
Cytoskeleton-associated protein 4
Recommended Applications
- Orthogonal validation (IHC): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직에서 검증
- Independent validation (WB): 서로 다른 epitope을 인식하는 독립적 항체와 비교하여 단백질 발현 검증
Product Description
Polyclonal Antibody against Human CKAP4
Alternative Gene Names
CLIMP-63, ERGIC-63, P63
Antigen Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cytoskeleton-associated protein 4 |
| Target Gene | CKAP4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQ |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000046841 | 73% |
| Rat | ENSRNOG00000008016 | 68% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CKAP5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CKAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CKAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CKAP2L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CKAP2L Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.