AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CKAP4 Antibody
상품 한눈에 보기
Human CKAP4 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 WB 검증 완료. Rabbit에서 생산된 IgG 항체로 높은 특이성과 재현성을 제공. Affinity purification으로 정제되어 신뢰성 높은 단백질 발현 분석에 적합.
- 카탈로그번호
- HPA000792-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA000792-100 Anti-CKAP4 Antibody, cytoskeleton-associated protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000792-25 Anti-CKAP4 Antibody, cytoskeleton-associated protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CKAP4 Antibody
Anti-CKAP4 Antibody
Target: Cytoskeleton-associated protein 4
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직 간 검증.
- WB (Independent validation): 서로 다른 에피토프를 인식하는 독립 항체를 사용하여 단백질 발현 검증.
Product Description
Polyclonal antibody against human CKAP4.
Alternative Gene Names
CLIMP-63, ERGIC-63, P63
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cytoskeleton-associated protein 4 |
| Target Gene | CKAP4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (73%), Rat (68%) |
Antigen Sequence:
SRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQ
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.