
Atlas Antibodies Anti-CHUK Antibody
인간 CHUK 단백질을 인식하는 폴리클론 항체로 IHC 및 ICC 적용에 적합합니다. Rabbit 유래 IgG 형식이며 PrEST 항원으로 친화 정제되었습니다. 높은 종간 보존성을 가지며 안정적인 PBS/glycerol buffer에 보존됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CHUK Antibody
Full Name: Conserved helix-loop-helix ubiquitous kinase
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human CHUK.
Alternative Gene Names
IkBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Conserved helix-loop-helix ubiquitous kinase |
| Target Gene | CHUK |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000022485 (90%), Mouse ENSMUSG00000025199 (88%) |
Antigen Sequence
HTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMN
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CIAO1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CHTOP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CHUK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CHURC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CHTOP Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|