
Atlas Antibodies Anti-CHURC1 Antibody
상품 한눈에 보기
인간 CHURC1 단백질을 인식하는 폴리클로날 항체로 IHC, WB(재조합 발현), ICC 실험에 적합합니다. Rabbit에서 생산된 IgG 항체이며 PrEST 항원을 이용해 친화 정제되었습니다. Human 반응성이 검증되었으며 높은 종간 서열 일치도를 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CHURC1 Antibody
churchill domain containing 1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human CHURC1
Alternative Gene Names
C14orf52, FLJ33064, My015
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | churchill domain containing 1 |
| Target Gene | CHURC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDP |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000007336 (97%)
- Mouse ENSMUSG00000090258 (96%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CHTOP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CHUK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CHURC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CHTOP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CHTF8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.