Atlas Antibodies Anti-CHAMP1 Antibody
상품 한눈에 보기
인간 CHAMP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 및 유전자 수준에서 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CHAMP1 Antibody
Target: chromosome alignment maintaining phosphoprotein 1 (CHAMP1)
Type: Polyclonal Antibody against Human CHAMP1
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation in Western blot by siRNA knockdown.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody raised in rabbit against human CHAMP1.
Validated for multiple applications with enhanced validation standards.
Alternative Gene Names
C13orf8, CAMP, CHAMP, ZNF828
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome alignment maintaining phosphoprotein 1 |
| Target Gene | CHAMP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCNSAEPKSIPALSMETQKLGSVLSPESPKPTPLTPLEPQKPGSVVSPELQTPLPSPEPSKPASVSSPEPP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000000112 (51%), Mouse ENSMUSG00000047710 (47%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-CHCHD1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CHAT Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CHAMP1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CHAD Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CHADL Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.