
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CHAMP1 Antibody
상품 한눈에 보기
인간 CHAMP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 및 유전자 수준에서 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA006623-100 Anti-CHAMP1 Antibody, chromosome alignment maintaining phosphoprotein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006623-25 Anti-CHAMP1 Antibody, chromosome alignment maintaining phosphoprotein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CHAMP1 Antibody
Anti-CHAMP1 Antibody
Target: chromosome alignment maintaining phosphoprotein 1 (CHAMP1)
Type: Polyclonal Antibody against Human CHAMP1
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation in Western blot by siRNA knockdown.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody raised in rabbit against human CHAMP1.
Validated for multiple applications with enhanced validation standards.
Alternative Gene Names
C13orf8, CAMP, CHAMP, ZNF828
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome alignment maintaining phosphoprotein 1 |
| Target Gene | CHAMP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCNSAEPKSIPALSMETQKLGSVLSPESPKPTPLTPLEPQKPGSVVSPELQTPLPSPEPSKPASVSSPEPP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000000112 (51%), Mouse ENSMUSG00000047710 (47%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



