CacheBy
Atlas Antibodies Anti-CHAD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHAD Antibody

상품 한눈에 보기

Human CHAD 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 검증 및 RNA-seq 데이터 비교를 통한 직교 검증 완료. 고순도 친화 정제 방식으로 제조되며, 다양한 조직 내 CHAD 발현 연구에 적합.

카탈로그번호
HPA018241-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018241-100 Anti-CHAD Antibody, chondroadherin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018241-25 Anti-CHAD Antibody, chondroadherin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHAD Antibody

Anti-CHAD Antibody

Target protein: chondroadherin (CHAD)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human CHAD.


Alternative Gene Names

SLRR4A

Open Datasheet (PDF)


Antigen Information

  • Antigen type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
  • Antigen sequence:
    LRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000039084): 95%
  • Rat (ENSRNOG00000003304): 94%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.