
Atlas Antibodies Anti-CFAP410 Antibody
상품 한눈에 보기
Human CFAP410 단백질에 대한 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합함. Rabbit 유래 IgG 형태이며 PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 40% glycerol 기반 PBS buffer에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CFAP410 Antibody
Target: chromosome 21 open reading frame 2 (CFAP410)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human CFAP410 protein.
Alternative Gene Names
A2, LRRC76, YF5, C21orf2
Recommended Applications
Immunocytochemistry (ICC)
Target Information
- Target Protein: chromosome 21 open reading frame 2
- Target Gene: CFAP410
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAA
Species Reactivity
- Verified: Human
- Interspecies Identity:
- Mouse (ENSMUSG00000020284): 86%
- Rat (ENSRNOG00000001215): 85%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CFAP44 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CFAP45 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CFAP410 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CFAP36 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CFAP36 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.