CacheBy
Atlas Antibodies Anti-CFAP410 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CFAP410 Antibody

상품 한눈에 보기

Human CFAP410 단백질에 대한 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합함. Rabbit 유래 IgG 형태이며 PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 40% glycerol 기반 PBS buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030283-100 Anti-CFAP410 Antibody, chromosome 21 open reading frame 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030283-25 Anti-CFAP410 Antibody, chromosome 21 open reading frame 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CFAP410 Antibody

Anti-CFAP410 Antibody

Target: chromosome 21 open reading frame 2 (CFAP410)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CFAP410 protein.

Alternative Gene Names

A2, LRRC76, YF5, C21orf2

Immunocytochemistry (ICC)

Target Information

  • Target Protein: chromosome 21 open reading frame 2
  • Target Gene: CFAP410
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    PVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAA

Species Reactivity

  • Verified: Human
  • Interspecies Identity:
    • Mouse (ENSMUSG00000020284): 86%
    • Rat (ENSRNOG00000001215): 85%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.