
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CFAP410 Antibody
상품 한눈에 보기
Human CFAP410 단백질에 대한 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합함. Rabbit 유래 IgG 형태이며 PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 40% glycerol 기반 PBS buffer에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030283-100 Anti-CFAP410 Antibody, chromosome 21 open reading frame 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030283-25 Anti-CFAP410 Antibody, chromosome 21 open reading frame 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CFAP410 Antibody
Anti-CFAP410 Antibody
Target: chromosome 21 open reading frame 2 (CFAP410)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human CFAP410 protein.
Alternative Gene Names
A2, LRRC76, YF5, C21orf2
Recommended Applications
Immunocytochemistry (ICC)
Target Information
- Target Protein: chromosome 21 open reading frame 2
- Target Gene: CFAP410
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAA
Species Reactivity
- Verified: Human
- Interspecies Identity:
- Mouse (ENSMUSG00000020284): 86%
- Rat (ENSRNOG00000001215): 85%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



