Atlas Antibodies Anti-CFAP44 Antibody

상품 한눈에 보기

Human CFAP44 단백질을 인식하는 Rabbit Polyclonal 항체로, 섬모 및 편모 관련 단백질 연구에 적합. PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 응용에 사용 가능. Human에 대해 검증됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA067258-100 Anti-CFAP44 Antibody, cilia and flagella associated protein 44 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA067258-25 Anti-CFAP44 Antibody, cilia and flagella associated protein 44 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CFAP44 Antibody

Anti-CFAP44 Antibody

Target Information

Protein: Cilia and flagella associated protein 44
Gene: CFAP44
Alternative Gene Names: FLJ11142, WDR52

Product Description

Polyclonal antibody against Human CFAP44.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended for applications involving cilia and flagella associated protein studies.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HSFGYDCRKRANLQLLDDSIAIYIAGNQLIFLNLKTKEQIYLRSSSGEGIGVIGVHPHKTYFTVAEKGSFPDIIIYEYPSLRPYRVLRDGTEKG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000071550	76%
Rat	ENSRNOG00000028077	73%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Applications	IHC (Immunohistochemistry)
Datasheet	Open Datasheet (PDF)
MSDS	Material Safety Data Sheet