CacheBy
Atlas Antibodies Anti-CFAP44 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CFAP44 Antibody

상품 한눈에 보기

Human CFAP44 단백질을 인식하는 Rabbit Polyclonal 항체로, 섬모 및 편모 관련 단백질 연구에 적합. PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 응용에 사용 가능. Human에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067258-100 Anti-CFAP44 Antibody, cilia and flagella associated protein 44 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067258-25 Anti-CFAP44 Antibody, cilia and flagella associated protein 44 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CFAP44 Antibody

Anti-CFAP44 Antibody

Target Information

  • Protein: Cilia and flagella associated protein 44
  • Gene: CFAP44
  • Alternative Gene Names: FLJ11142, WDR52

Product Description

Polyclonal antibody against Human CFAP44.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended for applications involving cilia and flagella associated protein studies.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HSFGYDCRKRANLQLLDDSIAIYIAGNQLIFLNLKTKEQIYLRSSSGEGIGVIGVHPHKTYFTVAEKGSFPDIIIYEYPSLRPYRVLRDGTEKG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000071550 76%
Rat ENSRNOG00000028077 73%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Applications IHC (Immunohistochemistry)
Datasheet Open Datasheet (PDF)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.