
Atlas Antibodies Anti-CENPT Antibody
상품 한눈에 보기
휴먼 CENPT를 타겟으로 한 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤/PBS 완충액에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CENPT Antibody
Target Information
- Target Protein: Centromere protein T
- Target Gene: CENPT
- Alternative Gene Names: C16orf56, CENP-T, FLJ13111
Product Description
Polyclonal antibody against human CENPT.
Recommended Applications
- Immunocytochemistry (ICC)
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence:
RGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSVFQQGV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000036672 | 73% |
| Rat | ENSRNOG00000024178 | 72% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CENPQ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CENPQ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CENPT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CENPP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CENPP Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.