AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CENPT Antibody
상품 한눈에 보기
휴먼 CENPT를 타겟으로 한 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤/PBS 완충액에 보존제로 sodium azide 포함.
- 카탈로그번호
- HPA041220-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041220-100 Anti-CENPT Antibody, centromere protein T 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041220-25 Anti-CENPT Antibody, centromere protein T 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CENPT Antibody
Anti-CENPT Antibody
Target Information
- Target Protein: Centromere protein T
- Target Gene: CENPT
- Alternative Gene Names: C16orf56, CENP-T, FLJ13111
Product Description
Polyclonal antibody against human CENPT.
Recommended Applications
- Immunocytochemistry (ICC)
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence:
RGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSVFQQGV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000036672 | 73% |
| Rat | ENSRNOG00000024178 | 72% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.