CacheBy
Atlas Antibodies Anti-CENPP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CENPP Antibody

상품 한눈에 보기

Human CENPP 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. Recombinant expression 기반 검증으로 높은 특이성과 재현성 제공. PrEST 항원을 이용해 친화 정제된 고품질 항체. 다양한 연구 응용에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021787-100 Anti-CENPP Antibody, centromere protein P 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021787-25 Anti-CENPP Antibody, centromere protein P 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CENPP Antibody

Anti-CENPP Antibody

Centromere protein P


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human CENPP


Alternative Gene Names

CENP-P, RP11-19J3.3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Centromere protein P
Target Gene CENPP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000021391 57%
Rat ENSRNOG00000062220 56%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.