AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CENPE Antibody
상품 한눈에 보기
Human CENPE 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고순도 IgG 형태로 제공됩니다. Human에 검증되었고 Rat, Mouse와도 상동성이 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042294-100 Anti-CENPE Antibody, centromere protein E, 312kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042294-25 Anti-CENPE Antibody, centromere protein E, 312kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CENPE Antibody
Anti-CENPE Antibody
Target: Centromere protein E (312 kDa)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CENPE.
Alternative Gene Names
KIF10, PPP1R61
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Centromere protein E, 312 kDa |
| Target Gene | CENPE |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000009339 (60%), Mouse ENSMUSG00000045328 (56%) |
Antigen Sequence:
EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.