
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CENPF Antibody
상품 한눈에 보기
인간 CENPF 단백질을 인식하는 폴리클로날 항체입니다. Rabbit에서 생산된 IgG 형식으로, PrEST 항원으로 정제되었습니다. ICC 등 다양한 응용에 적합하며 높은 특이성과 재현성을 제공합니다. Human에 대한 반응성이 검증되었습니다. 40% glycerol 기반 PBS buffer에 보존제를 포함합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA052382-100 Anti-CENPF Antibody, centromere protein F, 350/400kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052382-25 Anti-CENPF Antibody, centromere protein F, 350/400kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CENPF Antibody
Anti-CENPF Antibody
Target: Centromere protein F (350/400 kDa)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human CENPF.
Alternative Gene Names
- hcp-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Centromere protein F (350/400 kDa) |
| Target Gene | CENPF |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000003388 (65%), Mouse ENSMUSG00000026605 (63%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
CISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQEL
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



