CacheBy
Atlas Antibodies Anti-CEL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CEL Antibody

상품 한눈에 보기

Human CEL 단백질을 인식하는 Rabbit polyclonal 항체로, IHC Orthogonal 검증 완료. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human에 반응하며, BSSL, MODY8 유전자와 관련.

카탈로그번호
HPA052701-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052701-100 Anti-CEL Antibody, carboxyl ester lipase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052701-25 Anti-CEL Antibody, carboxyl ester lipase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CEL Antibody

Anti-CEL Antibody

Target: Carboxyl ester lipase (CEL)
Type: Polyclonal Antibody against Human CEL
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

This polyclonal antibody targets the human carboxyl ester lipase (CEL) protein.
It is affinity purified using the PrEST antigen as the affinity ligand to ensure high specificity.


Alternative Gene Names

BSSL, MODY8

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000010406 55%
Mouse ENSMUSG00000026818 49%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.