CacheBy
Atlas Antibodies Anti-CELA3A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CELA3A Antibody

상품 한눈에 보기

Human CELA3A 단백질을 인식하는 토끼 유래 폴리클로날 항체. 면역세포 염색 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 검증된 반응성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028086-100 Anti-CELA3A Antibody, chymotrypsin-like elastase family, member 3A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028086-25 Anti-CELA3A Antibody, chymotrypsin-like elastase family, member 3A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CELA3A Antibody

Anti-CELA3A Antibody

Target Information

  • Protein: Chymotrypsin-like elastase family, member 3A
  • Gene: CELA3A
  • Alternative Gene Names: ELA3, ELA3A

Product Description

Polyclonal antibody against human CELA3A.
Recommended for immunocytochemistry and related applications.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    HTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDIL

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Identity:
    • Mouse (ENSMUSG00000023433): 78%
    • Rat (ENSRNOG00000021619): 77%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Reference Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.