Thermo Fisher Scientific DENND4C Polyclonal Antibody
Rabbit polyclonal antibody targeting human DENND4C. Validated for WB, IHC(P), and ICC/IF applications. Antigen affinity purified, unconjugated liquid form. Suitable for research use in studying RAB10 activation and GLUT4 vesicle trafficking.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL | - |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:20–1:50 | - |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL | - |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human DENND4C. Recombinant protein control fragment (Product #RP-91445). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2640520 |
Product Specific Information
Immunogen sequence:
ETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHYPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGALVYDEEIMA
Ortholog sequence identity:
- Mouse: 90%
- Rat: 89%
Target Information
DENND4C is a guanine nucleotide exchange factor (GEF) that activates RAB10. It promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB10 into its active GTP-bound form. This activation stimulates SLC2A4/GLUT4 glucose transporter-enriched vesicle delivery to the plasma membrane in response to insulin.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific B4GALNT1 Polyclonal Antibody
799,600원
Thermo Fisher Scientific
Thermo Fisher Scientific UGGT1 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific DENND4C Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific MOSC2 Polyclonal Antibody
799,600원
Thermo Fisher Scientific
Thermo Fisher Scientific EQTN Polyclonal Antibody
799,600원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|