Thermo Fisher Scientific DENND4C Polyclonal Antibody
Rabbit polyclonal antibody targeting human DENND4C. Validated for WB, IHC(P), and ICC/IF applications. Antigen affinity purified, unconjugated liquid form. Suitable for research use in studying RAB10 activation and GLUT4 vesicle trafficking.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific DENND4C Polyclonal Antibody
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL | - |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:20–1:50 | - |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL | - |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human DENND4C. Recombinant protein control fragment (Product #RP-91445). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2640520 |
Product Specific Information
Immunogen sequence:
ETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHYPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGALVYDEEIMA
Ortholog sequence identity:
- Mouse: 90%
- Rat: 89%
Target Information
DENND4C is a guanine nucleotide exchange factor (GEF) that activates RAB10. It promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB10 into its active GTP-bound form. This activation stimulates SLC2A4/GLUT4 glucose transporter-enriched vesicle delivery to the plasma membrane in response to insulin.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.