Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), FITC
SUR2A 단백질을 인식하는 FITC 결합 단일클론 항체로, WB, IHC, ICC/IF에 사용 가능. 인간, 마우스, 랫트 반응성. 단백질 G로 정제된 액상 형태이며, 4°C 암소 보관. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:1,000 | - |
| Immunohistochemistry (IHC) | Assay-dependent | - |
| Immunocytochemistry (ICC/IF) | Assay-dependent | - |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N319A/14 |
| Immunogen | Fusion protein amino acids 1505–1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Conjugate | FITC |
| Excitation / Emission Max | 498 / 517 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | 9.09 mM sodium bicarbonate/PBS, pH 7.4, with 640.91 mM DMSO, 136.36 mM ethanolamine |
| Contains | No preservative |
| Storage Conditions | 4°C, store in dark |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932062 |
Additional Formats
- Unconjugated (MA5-27637)
- APC (MA5-45607)
- PE (MA5-45610)
- PerCP (MA5-45609)
- Request custom conjugation available
Product Specific Information
- 1 µg/mL of MA5-45608 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
- Detects approximately 120 kDa. Does not cross-react with SUR2B.
- This antibody was formerly sold as clone S319A-14.
Target Information
Sulfonylurea receptors (SUR) are membrane proteins that serve as molecular targets of sulfonylurea class anti-diabetic drugs, promoting insulin release from pancreatic beta cells. SUR proteins form subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). Four Kir6.x and four SUR subunits assemble into a KATP channel, which regulates cellular energy balance by sensing intracellular ATP and ADP levels and modulating potassium channel activity accordingly.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific NMDAR2A Monoclonal Antibody (N327A/38), PerCP
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific NMDAR2A Monoclonal Antibody (N327A/38), FITC
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), FITC
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific NOTCH1 Monoclonal Antibody (N253/32), PerCP
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific NMDAR2A Monoclonal Antibody (N327A/38), APC
663,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|