
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CDR2 Antibody
상품 한눈에 보기
Human CDR2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, 독립 항체 검증으로 신뢰성 확보. PrEST 항원으로 친화 정제됨. 인간에 대한 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018151-100 Anti-CDR2 Antibody, cerebellar degeneration-related protein 2, 62kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018151-25 Anti-CDR2 Antibody, cerebellar degeneration-related protein 2, 62kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CDR2 Antibody
Anti-CDR2 Antibody
Target: cerebellar degeneration-related protein 2 (62 kDa)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human CDR2.
Alternative Gene Names
CDR62, Yo
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cerebellar degeneration-related protein 2, 62 kDa |
| Target Gene | CDR2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000017260 (88%), Mouse ENSMUSG00000030878 (88%) |
Antigen Sequence:
GVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGV
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



