CacheBy
Atlas Antibodies Anti-CDNF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDNF Antibody

상품 한눈에 보기

Human CDNF를 인식하는 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. Rabbit에서 생산되었으며 IgG 아이소타입입니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044587-100 Anti-CDNF Antibody, cerebral dopamine neurotrophic factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044587-25 Anti-CDNF Antibody, cerebral dopamine neurotrophic factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDNF Antibody

Anti-CDNF Antibody

Target Information

  • Target Protein: Cerebral dopamine neurotrophic factor
  • Target Gene: CDNF
  • Alternative Gene Names: ARMETL1
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human CDNF.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000026493 85%
Mouse ENSMUSG00000039496 81%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.