CacheBy
Atlas Antibodies Anti-CDK7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDK7 Antibody

상품 한눈에 보기

인간 CDK7 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 정량적 단백질 발현 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Orthogonal validation으로 RNA-seq 데이터와의 일치성을 검증했습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008453-100 Anti-CDK7 Antibody, cyclin dependent kinase 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008453-25 Anti-CDK7 Antibody, cyclin dependent kinase 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDK7 Antibody

Anti-CDK7 Antibody

Target Information

  • Target Protein: cyclin-dependent kinase 7
  • Target Gene: CDK7
  • Alternative Gene Names: CAK, CAK1, CDKN7, MO15, STK1

Product Description

Polyclonal Antibody against Human CDK7

  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • WB (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression cell lines.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000018510 92%
Mouse ENSMUSG00000069089 89%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.