
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CDKL1 Antibody
상품 한눈에 보기
Human CDKL1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종 간 보존성을 보입니다. CDKL1 연구 및 세포주 분석에 유용합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059605-100 Anti-CDKL1 Antibody, cyclin-dependent kinase-like 1 (CDC2-related kinase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059605-25 Anti-CDKL1 Antibody, cyclin-dependent kinase-like 1 (CDC2-related kinase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CDKL1 Antibody
Anti-CDKL1 Antibody
Target: cyclin-dependent kinase-like 1 (CDC2-related kinase)
Product Type: Polyclonal Antibody against Human CDKL1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
This polyclonal antibody targets human CDKL1, a cyclin-dependent kinase-like protein involved in cell cycle regulation and neuronal development.
Alternative Gene Names
- KKIALRE
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cyclin-dependent kinase-like 1 (CDC2-related kinase) |
| Target Gene | CDKL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK |
| Verified Species Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000038720 (90%), Mouse ENSMUSG00000020990 (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



