CacheBy
Atlas Antibodies Anti-CDKL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDKL1 Antibody

상품 한눈에 보기

Human CDKL1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종 간 보존성을 보입니다. CDKL1 연구 및 세포주 분석에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059605-100 Anti-CDKL1 Antibody, cyclin-dependent kinase-like 1 (CDC2-related kinase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059605-25 Anti-CDKL1 Antibody, cyclin-dependent kinase-like 1 (CDC2-related kinase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDKL1 Antibody

Anti-CDKL1 Antibody

Target: cyclin-dependent kinase-like 1 (CDC2-related kinase)
Product Type: Polyclonal Antibody against Human CDKL1


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

This polyclonal antibody targets human CDKL1, a cyclin-dependent kinase-like protein involved in cell cycle regulation and neuronal development.


Alternative Gene Names

  • KKIALRE

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cyclin-dependent kinase-like 1 (CDC2-related kinase)
Target Gene CDKL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK
Verified Species Reactivity Human
Ortholog Identity Rat ENSRNOG00000038720 (90%), Mouse ENSMUSG00000020990 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.