CacheBy
Atlas Antibodies Anti-CDK2AP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDK2AP2 Antibody

상품 한눈에 보기

인간 CDK2AP2 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 재조합 발현 검증 완료. 친화 정제 방식으로 높은 특이성과 재현성 제공. 글리세롤 기반 완충액으로 안정적 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047599-100 Anti-CDK2AP2 Antibody, cyclin-dependent kinase 2 associated protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047599-25 Anti-CDK2AP2 Antibody, cyclin-dependent kinase 2 associated protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDK2AP2 Antibody

Anti-CDK2AP2 Antibody

Target: cyclin-dependent kinase 2 associated protein 2

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
    • Recombinant expression validation in WB using target protein overexpression.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human CDK2AP2.

Alternative Gene Names

DOC-1R, p14

Open Datasheet

Target Information

항목 내용
Target Protein cyclin-dependent kinase 2 associated protein 2
Target Gene CDK2AP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMG
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000097485 (96%), Rat ENSRNOG00000018391 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.