Atlas Antibodies Anti-CDK5 Antibody

상품 한눈에 보기

Human CDK5 단백질을 인식하는 토끼 다클론 항체로, IHC 및 ICC 실험에 적합합니다. Orthogonal validation으로 단백질 발현을 RNA-seq 데이터와 비교 검증하였으며, 고순도의 Affinity 정제 항체입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA064535-100 Anti-CDK5 Antibody, cyclin-dependent kinase 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA064535-25 Anti-CDK5 Antibody, cyclin-dependent kinase 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cyclin-dependent kinase 5 (CDK5)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Polyclonal antibody against human CDK5.

항목	내용
Target Protein	cyclin-dependent kinase 5
Target Gene	CDK5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	TEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCP
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000008017 (99%), Mouse ENSMUSG00000028969 (99%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand