CacheBy
Atlas Antibodies Anti-CDK18 Antibody
원본

Atlas Antibodies Anti-CDK18 Antibody

상품 한눈에 보기

Human CDK18 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. CDK18 관련 연구 및 세포주 분석에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045429-100 Anti-CDK18 Antibody, cyclin-dependent kinase 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045429-25 Anti-CDK18 Antibody, cyclin-dependent kinase 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDK18 Antibody

Anti-CDK18 Antibody

Target Protein: cyclin-dependent kinase 18
Product Type: Polyclonal Antibody against Human CDK18


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human cyclin-dependent kinase 18 (CDK18).


Alternative Gene Names

  • PCTAIRE3
  • PCTK3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cyclin-dependent kinase 18
Target Gene CDK18
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000008137 (64%), Mouse ENSMUSG00000026437 (59%)

Antigen Sequence:
MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQ


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.