CacheBy
Atlas Antibodies Anti-CDK5RAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDK5RAP1 Antibody

상품 한눈에 보기

Human CDK5RAP1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공합니다. 다양한 종 교차 반응성 정보 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066301-100 Anti-CDK5RAP1 Antibody, CDK5 regulatory subunit associated protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066301-25 Anti-CDK5RAP1 Antibody, CDK5 regulatory subunit associated protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDK5RAP1 Antibody

Anti-CDK5RAP1 Antibody

Target: CDK5 regulatory subunit associated protein 1
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CDK5RAP1.


Alternative Gene Names

C20orf34, C42, CGI-05, HSPC167

Open Datasheet (PDF)


Target Information

  • Target Protein: CDK5 regulatory subunit associated protein 1
  • Target Gene: CDK5RAP1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RLKDDVPEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLVKITSAS

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000027487 89%
Rat ENSRNOG00000015696 86%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.