CacheBy
Atlas Antibodies Anti-CDK20 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDK20 Antibody

상품 한눈에 보기

인간 CDK20 단백질을 인식하는 폴리클론 항체로, IHC 및 WB에서 검증됨. Orthogonal validation과 recombinant expression으로 신뢰성 확보. Rabbit 호스트에서 생산되며, Affinity purification 방식 적용. CCRK, p42 대체 유전자명 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007666-100 Anti-CDK20 Antibody, cyclin-dependent kinase 20 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007666-25 Anti-CDK20 Antibody, cyclin-dependent kinase 20 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDK20 Antibody

Anti-CDK20 Antibody

Target: cyclin-dependent kinase 20 (CDK20)
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human CDK20


Alternative Gene Names

  • CCRK
  • p42

Open Datasheet


Target Information

항목 내용
Target Protein cyclin-dependent kinase 20
Target Gene CDK20
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000021483 (87%)
Rat ENSRNOG00000017991 (86%)

Antigen Sequence:
RSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASK


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
IHC Tooltip Orthogonal
WB Recombinant Expression
WB Tooltip Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.