CacheBy
Atlas Antibodies Anti-CDK14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDK14 Antibody

상품 한눈에 보기

Human CDK14을 타겟으로 하는 고품질 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합. Rabbit 유래 IgG이며 PrEST 항원으로 정제됨. 높은 종간 반응성(96% Mouse) 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015267-100 Anti-CDK14 Antibody, cyclin-dependent kinase 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015267-25 Anti-CDK14 Antibody, cyclin-dependent kinase 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDK14 Antibody

Anti-CDK14 Antibody

Target Information

  • Target Protein: cyclin-dependent kinase 14
  • Target Gene: CDK14
  • Alternative Gene Names: PFTAIRE1, PFTK1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG

Product Description

Polyclonal Antibody against Human CDK14.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000028926 96%
Rat ENSRNOG00000006000 23%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.