CacheBy
Atlas Antibodies Anti-CDK16 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDK16 Antibody

상품 한눈에 보기

Human CDK16 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형태입니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. 높은 종간 서열 일치도를 보여 인체 연구에 최적화되어 있습니다.

카탈로그번호
HPA001366-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001366-100 Anti-CDK16 Antibody, cyclin-dependent kinase 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001366-25 Anti-CDK16 Antibody, cyclin-dependent kinase 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDK16 Antibody

Anti-CDK16 Antibody

Target Information

  • Target Protein: cyclin-dependent kinase 16
  • Target Gene: CDK16
  • Alternative Gene Names: FLJ16665, PCTAIRE, PCTAIRE1, PCTGAIRE, PCTK1

Product Description

Polyclonal Antibody against Human CDK16

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPAD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000031065 (96%)
  • Rat ENSRNOG00000008578 (96%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as ligand
Recommended Applications ICC (Immunocytochemistry)
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.