CacheBy
Atlas Antibodies Anti-CDK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDK3 Antibody

상품 한눈에 보기

Human CDK3를 인식하는 rabbit polyclonal antibody로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, glycerol/PBS buffer에 보존되어 있습니다. 인간에 대해 검증되었고, 사용 전 부드럽게 혼합을 권장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007420-100 Anti-CDK3 Antibody, cyclin-dependent kinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007420-25 Anti-CDK3 Antibody, cyclin-dependent kinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDK3 Antibody

Anti-CDK3 Antibody

Target: cyclin-dependent kinase 3 (CDK3)
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human CDK3.
Open Datasheet (PDF)

Target Information

항목 내용
Target Protein cyclin-dependent kinase 3
Target Gene CDK3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000025358 (49%), Rat ENSRNOG00000006469 (49%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.