
Atlas Antibodies Anti-CD99L2 Antibody
상품 한눈에 보기
인간 CD99L2 단백질에 대한 고품질 폴리클로날 항체. IHC를 통한 단백질 발현 Orthogonal 검증에 적합. Rabbit 유래 IgG 형식으로 Affinity 정제. 인간에 대한 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CD99L2 Antibody
CD99 molecule-like 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human CD99L2.
Alternative Gene Names
CD99B, MIC2L1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CD99 molecule-like 2 |
| Target Gene | CD99L2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000035776 (72%), Rat ENSRNOG00000024953 (70%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
DDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CDA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDADC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD99L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD93 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD99L2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.