CacheBy
Atlas Antibodies Anti-CDA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDA Antibody

상품 한눈에 보기

Human CDA 단백질을 인식하는 고품질 폴리클론 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증 완료. Rabbit 호스트에서 생산된 Affinity purified 항체.

카탈로그번호
HPA064202-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064202-100 Anti-CDA Antibody, cytidine deaminase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064202-25 Anti-CDA Antibody, cytidine deaminase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDA Antibody

Anti-CDA Antibody

Target: Cytidine deaminase (CDA)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Orthogonal validation:
Protein expression verified using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CDA


Alternative Gene Names

  • CDD

Open Datasheet


Target Information

항목 내용
Target Protein Cytidine deaminase
Target Gene CDA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000049700 (87%), Mouse ENSMUSG00000028755 (84%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

GICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQE

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.