CacheBy
Atlas Antibodies Anti-CD2BP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CD2BP2 Antibody

상품 한눈에 보기

Human CD2BP2 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며 RNA-seq 데이터와 비교한 정교한 오쏘고날 검증 제공. PrEST 항원 기반 친화 정제, 높은 인간 특이성 및 교차 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061309-100 Anti-CD2BP2 Antibody, CD2 (cytoplasmic tail) binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061309-25 Anti-CD2BP2 Antibody, CD2 (cytoplasmic tail) binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CD2BP2 Antibody

Anti-CD2BP2 Antibody

CD2 (cytoplasmic tail) binding protein 2

  • IHC (Orthogonal validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CD2BP2

Alternative Gene Names

LIN1, PPP1R59, Snu40

Open Datasheet

Target Information

항목 내용
Target Protein CD2 (cytoplasmic tail) binding protein 2
Target Gene CD2BP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (91%), Rat (89%)

Antigen Sequence:
LGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLY

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.