
Atlas Antibodies Anti-CD2BP2 Antibody
Human CD2BP2 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며 RNA-seq 데이터와 비교한 정교한 오쏘고날 검증 제공. PrEST 항원 기반 친화 정제, 높은 인간 특이성 및 교차 반응성 확인.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CD2BP2 Antibody
CD2 (cytoplasmic tail) binding protein 2
Recommended Applications
- IHC (Orthogonal validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CD2BP2
Alternative Gene Names
LIN1, PPP1R59, Snu40
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CD2 (cytoplasmic tail) binding protein 2 |
| Target Gene | CD2BP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (91%), Rat (89%) |
Antigen Sequence:
LGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLY
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CD2BP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD2AP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD2BP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD2AP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD276 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|