Atlas Antibodies Anti-CD276 Antibody

상품 한눈에 보기

Human CD276(B7-H3) 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 검증 완료. Recombinant PrEST 항원을 이용해 Affinity purification 수행. 인간 시료에 최적화되어 있으며, 40% glycerol 기반 buffer에 보존됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA017139-100 Anti-CD276 Antibody, CD276 molecule 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA017139-25 Anti-CD276 Antibody, CD276 molecule 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CD276 Antibody

Anti-CD276 Antibody

Target Information

Target Protein: CD276 molecule
Target Gene: CD276
Alternative Gene Names: B7-H3, B7H3, B7RP-2

Product Description

Polyclonal antibody against human CD276.
Validated for use in immunohistochemistry (IHC) and western blot (WB).

Recommended Applications

IHC (Orthogonal Validation):
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant Expression Validation):
Recombinant expression validation in WB using target protein overexpression.

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP

Species Reactivity

Verified Species: Human
Ortholog Sequence Identity:
- Rat ENSRNOG00000033608 (95%)
- Mouse ENSMUSG00000035914 (95%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet