
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CD276 Antibody
상품 한눈에 보기
Human CD276(B7-H3) 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 검증 완료. Recombinant PrEST 항원을 이용해 Affinity purification 수행. 인간 시료에 최적화되어 있으며, 40% glycerol 기반 buffer에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA017139-100 Anti-CD276 Antibody, CD276 molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017139-25 Anti-CD276 Antibody, CD276 molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CD276 Antibody
Anti-CD276 Antibody
Target Information
- Target Protein: CD276 molecule
- Target Gene: CD276
- Alternative Gene Names: B7-H3, B7H3, B7RP-2
Product Description
Polyclonal antibody against human CD276.
Validated for use in immunohistochemistry (IHC) and western blot (WB).
Recommended Applications
- IHC (Orthogonal Validation):
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Recombinant Expression Validation):
Recombinant expression validation in WB using target protein overexpression.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
Species Reactivity
- Verified Species: Human
- Ortholog Sequence Identity:
- Rat ENSRNOG00000033608 (95%)
- Mouse ENSMUSG00000035914 (95%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



