
Atlas Antibodies Anti-CD276 Antibody
상품 한눈에 보기
Human CD276(B7-H3) 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 검증 완료. Recombinant PrEST 항원을 이용해 Affinity purification 수행. 인간 시료에 최적화되어 있으며, 40% glycerol 기반 buffer에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CD276 Antibody
Target Information
- Target Protein: CD276 molecule
- Target Gene: CD276
- Alternative Gene Names: B7-H3, B7H3, B7RP-2
Product Description
Polyclonal antibody against human CD276.
Validated for use in immunohistochemistry (IHC) and western blot (WB).
Recommended Applications
- IHC (Orthogonal Validation):
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Recombinant Expression Validation):
Recombinant expression validation in WB using target protein overexpression.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
Species Reactivity
- Verified Species: Human
- Ortholog Sequence Identity:
- Rat ENSRNOG00000033608 (95%)
- Mouse ENSMUSG00000035914 (95%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CD2BP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD2AP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD276 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD28 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CD226 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.