
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CCL27 Antibody
상품 한눈에 보기
인간 CCL27 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석에 적합. RNA-seq 데이터 기반 정교한 직교 검증 수행. 고순도 친화 정제 방식으로 높은 특이성과 재현성 제공. 다양한 조직 발현 비교 연구에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA073848-100 Anti-CCL27 Antibody, C-C motif chemokine ligand 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073848-25 Anti-CCL27 Antibody, C-C motif chemokine ligand 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CCL27 Antibody
Anti-CCL27 Antibody
C-C motif chemokine ligand 27
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CCL27
Alternative Gene Names
ALP, CTACK, CTAK, ESkine, ILC, PESKY, SCYA27, skinkine
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | C-C motif chemokine ligand 27 |
| Target Gene | CCL27 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000039530 (62%)
- Mouse ENSMUSG00000096826 (62%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



